PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G40430.1
Common NameAtMYB22, MYB22
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 256aa    MW: 30087.8 Da    PI: 6.0085
Description myb domain protein 22
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G40430.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-155498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     ++rWT+ Ed +l++ v++ +++ W+++a+++  gRt+kqc++rw+++
      AT5G40430.1 54 KKRWTESEDIKLKEMVALEPKK-WTKVAKHFE-GRTPKQCRERWHNH 98
                     68********************.*********.************97 PP

2Myb_DNA-binding43.66.8e-14106149247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        W++eEd++l++++k  G + W  I++ ++ gR+ +++k++w++ 
      AT5G40430.1 106 TTWSEEEDQILIEVHKVIGAK-WIQISEQLP-GRSYNNVKNHWNTT 149
                      68*******************.*********.************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.74949103IPR017930Myb domain
SMARTSM007177.0E-1553101IPR001005SANT/Myb domain
CDDcd001672.99E-115698No hitNo description
Gene3DG3DSA:1.10.10.609.4E-2156103IPR009057Homeodomain-like
PfamPF139211.9E-1557114No hitNo description
SuperFamilySSF466891.05E-2679159IPR009057Homeodomain-like
PROSITE profilePS5129418.774104154IPR017930Myb domain
SMARTSM007175.5E-12104152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-18104152IPR009057Homeodomain-like
CDDcd001671.29E-7107150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGEPQLFDVP VLEGIKNTTN EIMNQLEDDK MKKTYENKKE ASTSKYLKKS DITKKRWTES  60
EDIKLKEMVA LEPKKWTKVA KHFEGRTPKQ CRERWHNHAR PNVKKTTWSE EEDQILIEVH  120
KVIGAKWIQI SEQLPGRSYN NVKNHWNTTK RRVQNKSGRT VNRVGNNILE NYIRSITINN  180
DDESDGEPTN IENYHDDSED MLYGEMNLSP EAITQTTKPL TDASTISPYI PMPKENYTLE  240
VCESLEDYLE LLRWWD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-34511524106B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO58233040.0
Genevisible249352_at0.0
Expression AtlasAT5G40430-
AtGenExpressAT5G40430-
ATTED-IIAT5G40430-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB22).
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G40430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G40430
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759860.0AF175986.1 Arabidopsis thaliana putative transcription factor (MYB22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_568582.10.0putative transcription factor MYB22
SwissprotQ9S7L21e-37MYB98_ARATH; Transcription factor MYB98
TrEMBLQ9SPH00.0Q9SPH0_ARATH; At5g40430
STRINGAT5G40430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1791069
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Molinier J,Oakeley EJ,Niederhauser O,Kovalchuk I,Hohn B
    Dynamic response of plant genome to ultraviolet radiation and other genotoxic stresses.
    Mutat. Res., 2005. 571(1-2): p. 235-47
    [PMID:15748650]
  4. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  5. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]